HPA020525

ADH4 antibody from Sigma-Aldrich
ADH-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020525
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020525, RRID:AB_1844609
Product name
Anti-ADH4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020525
Antibody type
Polyclonal
Antigen
Alcohol dehydrogenase 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDC
AGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTV
FPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNK
KFNLDALV
Storage
-20C
Provider Type Product Number
- No reagents -