HPA004722

UCKL1 antibody from Sigma-Aldrich
FLJ20517, URKL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004722
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004722, RRID:AB_1080455
Product name
Anti-UCKL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004722
Antibody type
Polyclonal
Antigen
Uridine/cytidine kinase-like 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVCKDVRIGTILIQTNQLTGEPELHYLRLPKDISD
DHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIFL
LSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLF
RIIPGIGNFGDRYFGTDAVPDGSDE
Storage
-20C
Provider Type Product Number
- No reagents -