Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA050654 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA050654, RRID:AB_2681203
- Product name
- Anti-FSCN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYN
IKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYN
KVAIKVGGRYLKGDHAGVLKASAETVDP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and colon tissues using Anti-FSCN1 antibody. Corresponding FSCN1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum, cerebral cortex, testis and tonsil using Anti-FSCN1 antibody HPA050654 (A) shows similar protein distribution across tissues to independent antibody HPA005723 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN