HPA005723

FSCN1 antibody from Sigma-Aldrich
FLJ38511, p55, SNL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005723
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005723, RRID:AB_1849159
Product name
Anti-FSCN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005723
Antibody type
Polyclonal
Antigen
Fascin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKDELFALEQSCAQVVLQAANERNVSTRQGMDLSA
NQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLT
ATGGVQSTASSKNASCYFDIEWRDRRITLRASNGK
FVTSKKNGQ
Storage
-20C
Provider Type Product Number
- No reagents -