H00084883-M13

AIFM2 antibody from Abnova Corporation
AMID, FLJ14497, PRG3

Antibody data

Product number
H00084883-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084883-M13, RRID:AB_1571173
Product name
AMID monoclonal antibody (M13), clone 2C6
Provider product page
Abnova Corporation - H00084883-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AMID.
Antigen sequence
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNV
PFMLVDMKDSFHHNVAALRASVETGFAKKTFISYS
VTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHL
ILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQ
RSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHS
QVALADKELLPSVRQEVKEILLRKGVQLLLSERVS
NLEELPLNEYREYIKVQTDKGTEVATNLVILCTGI
KINSSAYRKAFESRLASSGALRVNEHLQVEGHSNV
YAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQ
RPLQAYKPGALTFLLSMGRNDGVG
Isotype
IgG
Antibody clone number
2C6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -