HPA000724

antibody from Atlas Antibodies

Targeting: INF2 C14orf151, C14orf173, MGC13251

Antibody data

Submit

Validation data

Product number: HPA000724 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA000724, RRID:AB_1078325
Product name: Anti-INF2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQ GYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEG HVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVP YVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLL DVLAR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

INF2 protein structure - HPA000724 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human stomach and skeletal muscle tissues using HPA000724 antibody. Corresponding INF2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in podocytes, as well as moderate cytoplasmic positivity in a subset of tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in podocytes and cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity in striated muscle fibers.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Sample type: HUMAN