HPA000724

INF2 antibody from Atlas Antibodies
C14orf151, C14orf173, MGC13251
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000724
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000724, RRID:AB_1078325
Product name
Anti-INF2
Provider product page
Atlas Antibodies - HPA000724
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQ
GYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEG
HVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVP
YVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLL
DVLAR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -