ABIN629805

antibody from antibodies-online

Targeting: ADH6 ADH-5

Western blot

Antibody data

Submit

Validation data

Product number: ABIN629805 - Provider product page
Provider: antibodies-online
Product name: anti-Alcohol Dehydrogenase 6 (Class V) (ADH6) antibody
Antibody type: Polyclonal
Antigen: ADH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

ADH6 protein structure - ABIN629805 shown in red.