Antibody data

Product number
ABIN310073
Provider
antibodies-online
Product name
anti-Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1) antibody
Provider product page
antibodies-online - ABIN310073
Antibody type
Polyclonal
Antigen
The immunogen for anti-CPSF1 antibody: synthetic peptide directed towards the middle region of human CPSF1
Reactivity
Human
Host
Rabbit
Antigen sequence
GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEA
DDDGR RHGFLILSRE
Vial size
50 µg
Provider Type Product Number
- No reagents -