Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA047428 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA047428, RRID:AB_10963428
- Product name
- Anti-ZFP36L2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKA
VGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPS
PGSCSPKF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Chromatin Modification and Global Transcriptional Silencing in the Oocyte Mediated by the mRNA Decay Activator ZFP36L2
ZFP36L2 promotes cancer cell aggressiveness and is regulated by antitumor microRNA-375 in pancreatic ductal adenocarcinoma.
Chousal J, Cho K, Ramaiah M, Skarbrevik D, Mora-Castilla S, Stumpo D, Lykke-Andersen J, Laurent L, Blackshear P, Wilkinson M, Cook-Andersen H
Developmental Cell 2018;44(3):392-402.e7
Developmental Cell 2018;44(3):392-402.e7
ZFP36L2 promotes cancer cell aggressiveness and is regulated by antitumor microRNA-375 in pancreatic ductal adenocarcinoma.
Yonemori K, Seki N, Kurahara H, Osako Y, Idichi T, Arai T, Koshizuka K, Kita Y, Maemura K, Natsugoe S
Cancer science 2017 Jan;108(1):124-135
Cancer science 2017 Jan;108(1):124-135
No comments: Submit comment
No validations: Submit validation data