HPA018465

TMEM38B antibody from Sigma-Aldrich
bA219P18.1, C9orf87, D4Ertd89e, FLJ10493, TRIC-B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018465
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018465, RRID:AB_1858116
Product name
Anti-TMEM38B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018465
Antibody type
Polyclonal
Antigen
Trimeric intracellular cation channel type B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSL
ASKPVDVASDNV
Storage
-20C
Provider Type Product Number
- No reagents -