HPA018465

TMEM38B antibody from Atlas Antibodies
bA219P18.1, C9orf87, D4Ertd89e, FLJ10493, TRIC-B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018465
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018465, RRID:AB_1858116
Product name
Anti-TMEM38B
Provider product page
Atlas Antibodies - HPA018465
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSL
ASKPVDVASDNV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -