HPA017937

NUP93 antibody from Sigma-Aldrich
KIAA0095
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017937, RRID:AB_1854726
Product name
Anti-NUP93 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017937
Antibody type
Polyclonal
Antigen
Nuclear pore complex protein Nup93 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VERNLQEIQQAGERLRSRTLTRTSQETADVKASVL
LGSRGLDISHISQRLESLSAATTFEPLEPVKDTDI
QGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESM
LVEWEQVKQRI
Storage
-20C
Provider Type Product Number
- No reagents -