HPA017937

NUP93 antibody from Atlas Antibodies
KIAA0095
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017937
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017937, RRID:AB_1854726
Product name
Anti-NUP93
Provider product page
Atlas Antibodies - HPA017937
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VERNLQEIQQAGERLRSRTLTRTSQETADVKASVL
LGSRGLDISHISQRLESLSAATTFEPLEPVKDTDI
QGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESM
LVEWEQVKQRI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -