HPA004744

ARHGEF7 antibody from Sigma-Aldrich
BETA-PIX, COOL1, DKFZp686C12170, DKFZp761K1021, KIAA0142, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004744
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004744, RRID:AB_1845332
Product name
Anti-ARHGEF7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004744
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISG
SMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNP
TIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAY
HTLPHPSHHGTPHTTINWGPLEPPKTPKPW
Storage
-20C
Provider Type Product Number
- No reagents -