ABIN629844

antibody from antibodies-online

Targeting: ADH1B ADH2

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN629844 - Provider product page
Provider: antibodies-online
Product name: anti-Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B) antibody
Antibody type: Polyclonal
Antigen: ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV
Description: Purified
Reactivity: Human
Host: Rabbit
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

ADH1B protein structure - ABIN629844 shown in red.