HPA026874

GANAB antibody from Atlas Antibodies
G2AN, GIIA, GluII, KIAA0088
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026874
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026874, RRID:AB_1849745
Product name
Anti-GANAB
Provider product page
Atlas Antibodies - HPA026874
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALG
QRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDV
TTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQ
GEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -