HPA026874

GANAB antibody from Sigma-Aldrich
G2AN, GIIA, GluII, KIAA0088
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026874
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026874, RRID:AB_1849745
Product name
Anti-GANAB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026874
Antibody type
Polyclonal
Antigen
Neutral alpha-glucosidase AB Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALG
QRYSLLPFWYTLLYQAHREGIPVMRPLWVQYPQDV
TTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQ
GEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQ
Storage
-20C
Provider Type Product Number
- No reagents -