HPA020096

PPA1 antibody from Atlas Antibodies
IOPPP, PP, PP1, Ppase, SID6-8061
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020096
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020096, RRID:AB_1855600
Product name
Anti-PPA1
Provider product page
Atlas Antibodies - HPA020096
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGIS
CMNTTLSESPFKCDPDAARAIVDALPPPCESACTV
PTDVDKWFHHQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -