HPA020096

PPA1 antibody from Sigma-Aldrich
IOPPP, PP, PP1, Ppase, SID6-8061
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020096
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020096, RRID:AB_1855600
Product name
Anti-PPA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020096
Antibody type
Polyclonal
Antigen
Inorganic pyrophosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGIS
CMNTTLSESPFKCDPDAARAIVDALPPPCESACTV
PTDVDKWFHHQ
Storage
-20C
Provider Type Product Number
- No reagents -