HPA024688

VPS28 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024688
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024688, RRID:AB_1858766
Product name
Anti-VPS28 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024688
Antibody type
Polyclonal
Antigen
Vacuolar protein sorting-associated protein 28 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREK
YDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC
S
Storage
-20C
Provider Type Product Number
- No reagents -