Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002889-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002889-M01, RRID:AB_464383
- Product name
- RAPGEF1 monoclonal antibody (M01), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAPGEF1.
- Antigen sequence
MGNAIEKQKPLKRSHLYPWKQDSQRSHLSSFTMKL
MDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEA
TDRFLPEGYPLPLDLEQQAVEFMSTSAVASRSQRQ
KNLSW- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The WAVE2 complex regulates T cell receptor signaling to integrins via Abl- and CrkL-C3G-mediated activation of Rap1.
Nolz JC, Nacusi LP, Segovis CM, Medeiros RB, Mitchell JS, Shimizu Y, Billadeau DD
The Journal of cell biology 2008 Sep 22;182(6):1231-44
The Journal of cell biology 2008 Sep 22;182(6):1231-44
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAPGEF1 expression in transfected 293T cell line by RAPGEF1 monoclonal antibody (M01), clone 3D10.Lane 1: RAPGEF1 transfected lysate(122.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAPGEF1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol