HPA006426

RAPGEF1 antibody from MilliporeSigma / Merck KGaA
C3G, GRF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006426
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006426, RRID:AB_1856070
Product name
Anti-RAPGEF1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006426
Antibody type
Polyclonal
Antigen
Rap guanine nucleotide exchange factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLP
GSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQ
SLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAV
LDGVKELVRLTIEKQGRPSPTSPVKPSSPASK
Storage
-20C
Provider Type Product Number
- No reagents -