Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009314-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009314-M02, RRID:AB_10755793
- Product name
- KLF4 monoclonal antibody (M02), clone X1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLF4.
- Antigen sequence
VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVA
PYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHR
PAAHDFPLGRQLPSRTTPTLGLEEVLSSRD- Isotype
- IgG
- Antibody clone number
- X1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of KLF4 expression in transfected 293T cell line by KLF4 monoclonal antibody (M02), clone X1.Lane 1: KLF4 transfected lysate(50.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- KLF4 monoclonal antibody (M02), clone X1. Western Blot analysis of KLF4 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged KLF4 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to KLF4 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
