HPA018990

ETFA antibody from Sigma-Aldrich
EMA, GA2, MADD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018990
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018990, RRID:AB_1848277
Product name
Anti-ETFA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018990
Antibody type
Polyclonal
Antigen
Electron transfer flavoprotein subunit alpha, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDAGFVPNDMQVGQTGKIVAPELYIAVGISGAIQH
LAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFK
VVPEMTEILK
Storage
-20C
Provider Type Product Number
- No reagents -