HPA024089

ETFA antibody from Sigma-Aldrich
EMA, GA2, MADD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024089
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024089, RRID:AB_1848278
Product name
Anti-ETFA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024089
Antibody type
Polyclonal
Antigen
Electron transfer flavoprotein subunit alpha, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGSASSEKASSTSPVEISEWLDQKLTKSDRPELTG
AKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASR
AA
Storage
-20C
Provider Type Product Number
- No reagents -