HPA021425

ERAL1 antibody from Sigma-Aldrich
HERA-B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021425
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021425, RRID:AB_1848228
Product name
Anti-ERAL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021425
Antibody type
Polyclonal
Antigen
GTP-binding protein era homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVP
YNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLL
IGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKL
LK
Storage
-20C
Provider Type Product Number
- No reagents -