HPA016514

ABCG5 antibody from Sigma-Aldrich
STSL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016514
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016514, RRID:AB_1844443
Product name
Anti-ABCG5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016514
Antibody type
Polyclonal
Antigen
ATP-binding cassette sub-family G member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDF
FNDCGYPCPEHSNPFDFYMDLTSVDTQSKEREIET
SKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPM
VPFKTKDSPGVFSKLGVLL
Storage
-20C
Provider Type Product Number
- No reagents -