SAB2102614

TXNDC16 antibody from Sigma-Aldrich
KIAA1344
No application information provided.

Antibody data

Product number
SAB2102614
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102614, RRID:AB_10606824
Product name
Anti-TXNDC16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102614
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_065835.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTEVAEDPQQVSTVHLQLGLPLVFIVSQQATYEAD
RRTAEWVAWRLLGKA
Storage
-20C
Provider Type Product Number
- No reagents -