Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005751 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005751, RRID:AB_1855350
- Product name
- Anti-PIK3R3
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NVWLGIKNEDADENYFINEEDENLPHYDEKTWFVE
DINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVV
ADGEVKHCVIYSTA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The PI3K regulatory subunit gene PIK3R1 is under direct control of androgens and repressed in prostate cancer cells.
Munkley J, Livermore KE, McClurg UL, Kalna G, Knight B, McCullagh P, McGrath J, Crundwell M, Leung HY, Robson CN, Harries LW, Rajan P, Elliott DJ
Oncoscience 2015;2(9):755-64
Oncoscience 2015;2(9):755-64
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.