HPA005751

PIK3R3 antibody from Sigma-Aldrich
p55
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005751
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005751, RRID:AB_1855350
Product name
Anti-PIK3R3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005751
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 3-kinase regulatory subunit gamma recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVWLGIKNEDADENYFINEEDENLPHYDEKTWFVE
DINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVV
ADGEVKHCVIYSTA
Storage
-20C
Provider Type Product Number
- No reagents -