HPA021803

ACTL7B antibody from Sigma-Aldrich
Tact1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021803
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021803, RRID:AB_1844551
Product name
Anti-ACTL7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021803
Antibody type
Polyclonal
Antigen
Actin-like protein 7B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGA
ATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPR
PTYFISSTVGKRCPEAADAGDTRKWTL
Storage
-20C
Provider Type Product Number
- No reagents -