HPA005724

VASP antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005724
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005724, RRID:AB_1858721
Product name
Anti-VASP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005724
Antibody type
Polyclonal
Antigen
Vasodilator-stimulated phosphoprotein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTP
KDESANQEEPEARVPAQSESVRRPWEKNSTTLPRM
KSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEV
KKELQKVK
Storage
-20C
Provider Type Product Number
- No reagents -