HPA019556

ABCG8 antibody from Sigma-Aldrich
GBD4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019556
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019556, RRID:AB_1844444
Product name
Anti-ABCG8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019556
Antibody type
Polyclonal
Antigen
ATP-binding cassette sub-family G member 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSRE
QELATREKAQSLAALFLEKVRDLDDFLWKAETKDL
DEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLI
RRQISNDFRDLP
Storage
-20C
Provider Type Product Number
- No reagents -