Antibody data
- Product number
- HPA021624
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021624, RRID:AB_1844549
- Product name
- Anti-ACTL7A
- Provider product page
- Atlas Antibodies - HPA021624
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRD
GPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTK
AVVVDLGTGYCKCGFAGLPRPTHKISTTVGK
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows distinct positivity.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ACTL7A antibody. Corresponding ACTL7A RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more