HPA021624

ACTL7A antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021624
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021624, RRID:AB_1844549
Product name
Anti-ACTL7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021624
Antibody type
Polyclonal
Antigen
Actin-like protein 7A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRD
GPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTK
AVVVDLGTGYCKCGFAGLPRPTHKISTTVGK
Storage
-20C
Provider Type Product Number
- No reagents -