Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00008518-M03 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00008518-M03, RRID:AB_530088
 - Product name
 - IKBKAP monoclonal antibody (M03), clone 6G9
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant IKBKAP.
 - Antigen sequence
 VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTL
TYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLD
AELFIPPKINRRTQWKLSLL- Isotype
 - IgG
 - Antibody clone number
 - 6G9
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		Familial Dysautonomia (FD) Human Embryonic Stem Cell Derived PNS Neurons Reveal that Synaptic Vesicular and Neuronal Transport Genes Are Directly or Indirectly Affected by IKBKAP Downregulation.
				
		
	
			Lefler S, Cohen MA, Kantor G, Cheishvili D, Even A, Birger A, Turetsky T, Gil Y, Even-Ram S, Aizenman E, Bashir N, Maayan C, Razin A, Reubinoff BE, Weil M
PloS one 2015;10(10):e0138807
		PloS one 2015;10(10):e0138807
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - IKBKAP monoclonal antibody (M03), clone 6G9 Western Blot analysis of IKBKAP expression in HeLa ( Cat # L013V1 ).
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged IKBKAP is approximately 0.3ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to IKBKAP on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol