H00002318-A01

FLNC antibody from Abnova Corporation
ABP-280, ABPL, FLN2

Antibody data

Product number
H00002318-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002318-A01, RRID:AB_489488
Product name
FLNC polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00002318-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant FLNC.
Antigen sequence
SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDC
SKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVT
YTVKEKGDYILIVKWGDESVPGSPFKVKVP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -