HPA006135

FLNC antibody from Atlas Antibodies
ABP-280, ABPL, FLN2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006135
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006135, RRID:AB_1848602
Product name
Anti-FLNC
Provider product page
Atlas Antibodies - HPA006135
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDA
SKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMV
GVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -