HPA006135

FLNC antibody from Sigma-Aldrich
ABP-280, ABPL, FLN2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006135
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006135, RRID:AB_1848602
Product name
Anti-FLNC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006135
Antibody type
Polyclonal
Antigen
Filamin-C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDA
SKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMV
GVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
Storage
-20C
Provider Type Product Number
- No reagents -