HPA017012

MRGBP antibody from Sigma-Aldrich
C20orf20, Eaf7, FLJ10914, MRG15BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017012
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017012, RRID:AB_1845679
Product name
Anti-C20orf20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017012
Antibody type
Polyclonal
Antigen
MRG-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVP
SKVIWDHLSTMYDMQALHESEILPFPNPERNFVLP
EEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDV
FSSSGSLGKASEKSSKDKEKNSSDLGCKE
Storage
-20C
Provider Type Product Number
- No reagents -