HPA029695

GPR132 antibody from MilliporeSigma / Merck KGaA
G2A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029695
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029695, RRID:AB_10601984
Product name
Anti-GPR132 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029695
Antibody type
Polyclonal
Antigen
G protein-coupled receptor 132 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESR
I
Storage
-20C
Provider Type Product Number
- No reagents -