HPA006136

SHC2 antibody from Sigma-Aldrich
SCK, SHCB, SLI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006136
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006136, RRID:AB_1856827
Product name
Anti-SHC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006136
Antibody type
Polyclonal
Antigen
SHC-transforming protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHLYVNTQGLDAPEPEDSPKKDLFDMRPFEDALKL
HECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEE
QLRQEPWYHGRMSRRAAERMLRADGD
Storage
-20C
Provider Type Product Number
- No reagents -