Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405730 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Jagged 2 (JAG2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-JAG2 antibody: synthetic peptide directed towards the N terminal of human JAG2
- Reactivity
- Human, Mouse, Rat, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSA
LRNVN GELLSGACCD- Vial size
- 50 µg
Submitted references Analysis of coding-polymorphisms in NOTCH-related genes reveals NUMBL poly-glutamine repeat to be associated with schizophrenia in Brazilian and Danish subjects.
Normal eye tracking is associated with abnormal morphology of medial temporal lobe structures in schizophrenia.
Passos Gregorio S, Gattaz WF, Tavares H, Kieling C, Timm S, Wang AG, Berg Rasmussen H, Werge T, Dias-Neto E
Schizophrenia research 2006 Dec;88(1-3):275-82
Schizophrenia research 2006 Dec;88(1-3):275-82
Normal eye tracking is associated with abnormal morphology of medial temporal lobe structures in schizophrenia.
Levy DL, Bogerts B, Degreef G, Dorogusker B, Waternaux C, Ashtari M, Jody D, Geisler S, Lieberman JA
Schizophrenia research 1992 Oct;8(1):1-10
Schizophrenia research 1992 Oct;8(1):1-10
No comments: Submit comment
No validations: Submit validation data