HPA022991

DHRS13 antibody from Atlas Antibodies
MGC23280, SDR7C5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022991
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022991, RRID:AB_1853865
Product name
Anti-DHRS13
Provider product page
Atlas Antibodies - HPA022991
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAP
SSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQA
KVEPEIQLS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -