HPA022991

DHRS13 antibody from Sigma-Aldrich
MGC23280, SDR7C5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022991
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022991, RRID:AB_1853865
Product name
Anti-DHRS13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022991
Antibody type
Polyclonal
Antigen
Dehydrogenase/reductase SDR family member 13 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAHRLWEASKRLAGLGPGEDAEPDEDPQSEDSEAP
SSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQA
KVEPEIQLS
Storage
-20C
Provider Type Product Number
- No reagents -