HPA016610

KDM3B antibody from Sigma-Aldrich
C5orf7, JMJD1B, KIAA1082, NET22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016610
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016610, RRID:AB_1852004
Product name
Anti-JMJD1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016610
Antibody type
Polyclonal
Antigen
JmjC domain-containing histone demethylation protein 2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQ
PPSTFVPQINRNIRFATYTKENGRTLVVQDEPVGG
DTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLE
QVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTV
PE
Storage
-20C
Provider Type Product Number
- No reagents -