HPA016610

KDM3B antibody from Atlas Antibodies
C5orf7, JMJD1B, KIAA1082, NET22
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA016610
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016610, RRID:AB_1234595
Product name
Anti-KDM3B
Provider product page
Atlas Antibodies - HPA016610
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQ
PPSTFVPQINRNIRFATYTKENGRTLVVQDEPVGG
DTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLE
QVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTV
PE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -