HPA023086

SGPL1 antibody from Sigma-Aldrich
SPL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023086
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023086, RRID:AB_1856804
Product name
Anti-SGPL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023086
Antibody type
Polyclonal
Antigen
Sphingosine-1-phosphate lyase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEA
EIVRIACSLFNGGPDSCGCVTSGGTESILMACKAY
RDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKI
VRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFP
HGVI
Storage
-20C
Provider Type Product Number
- No reagents -