HPA008427

ITGA7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008427
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008427, RRID:AB_1851823
Product name
Anti-ITGA7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008427
Antibody type
Polyclonal
Antigen
Integrin alpha-7 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FACPLSLEETDCYRVDIDQGADMQKESKENQWLGV
SVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIG
RCFVLSQDLAIRDELDGGEWKFCE
Storage
-20C
Provider Type Product Number
- No reagents -