HPA023755

PPP1R16A antibody from Atlas Antibodies
MGC14333, MYPT3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023755
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023755, RRID:AB_1854268
Product name
Anti-PPP1R16A
Provider product page
Atlas Antibodies - HPA023755
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLK
QVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLA
NE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -